PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g23320.4.p
Common NameBRADI_2g23320, LOC100843050
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 628aa    MW: 69427.1 Da    PI: 6.8416
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g23320.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.4e-1779125148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g WT+eEde l +av  + g++Wk+Ia+ ++  Rt+ qc +rwqk+l
  Bradi2g23320.4.p  79 KGGWTPEEDETLRKAVYAFKGKNWKKIAESFP-DRTEVQCLHRWQKVL 125
                       688*****************************.************986 PP

2Myb_DNA-binding61.12.3e-19131177148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g+WT+eEd+ +vd vk++G++ W++Ia+ +  gR +kqc++rw+++l
  Bradi2g23320.4.p 131 KGPWTQEEDDTIVDMVKKHGPRKWSLIAKSLD-GRIGKQCRERWHNHL 177
                       79******************************.*************97 PP

3Myb_DNA-binding63.25.2e-20183225145
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       + +WTteE++ lv+a++++G++ W+ Ia+ ++ gRt++++k++w+
  Bradi2g23320.4.p 183 KEAWTTEEEQVLVKAHHLHGNR-WAEIAKLLP-GRTDNSIKNHWN 225
                       579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.71174125IPR017930Myb domain
SMARTSM007171.1E-1478127IPR001005SANT/Myb domain
PfamPF002492.1E-1579125IPR001005SANT/Myb domain
SuperFamilySSF466892.37E-1580135IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.5E-2481142IPR009057Homeodomain-like
CDDcd001673.97E-1382125No hitNo description
PROSITE profilePS5129431.468126181IPR017930Myb domain
SuperFamilySSF466893.03E-31128224IPR009057Homeodomain-like
SMARTSM007176.6E-17130179IPR001005SANT/Myb domain
PfamPF002491.9E-17131177IPR001005SANT/Myb domain
CDDcd001673.99E-15133177No hitNo description
Gene3DG3DSA:1.10.10.609.5E-27143185IPR009057Homeodomain-like
PROSITE profilePS5129423.561182232IPR017930Myb domain
SMARTSM007171.7E-17182230IPR001005SANT/Myb domain
PfamPF002491.1E-17183226IPR001005SANT/Myb domain
CDDcd001674.99E-14185225No hitNo description
Gene3DG3DSA:1.10.10.604.8E-23186231IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 628 aa     Download sequence    Send to blast
MCEMKVEERG GCTESRQHLE LSSPSASEEG SYGGYARMSP AVSSPADSIS GRRSQTASFS  60
QKIKLSHLGR TSGPVRRAKG GWTPEEDETL RKAVYAFKGK NWKKIAESFP DRTEVQCLHR  120
WQKVLDPELI KGPWTQEEDD TIVDMVKKHG PRKWSLIAKS LDGRIGKQCR ERWHNHLDPQ  180
IRKEAWTTEE EQVLVKAHHL HGNRWAEIAK LLPGRTDNSI KNHWNSSVRK RIDDYSTRTV  240
MPVPLHATHI DLKHAAELSS AENHIDLNKE PSISLKDRPV IVDHSDLIQS PRVCSLKNIK  300
GCSDFLSLAM PTAQPLTLCE ASVSDDSAVA LAIMGLKMDS GHDKDMQLKC VSENSLEISL  360
SNERGLKIDL ITNKMRPSGL GKSEGEIANI GCESPSQNEA GSLGSLCYWI PMLDDTDLAH  420
SPVFSTHNVR ENSGIGFQSP TGYTTPSPTE GKKSDQLSVE SILKSAAENF PSTPSILRRR  480
KREKPTPAQD CELRIETNSD SFETPIGNFT TDSPHSFKTA SFLSFSHLDD QGLPADLGKC  540
DVSPSYRLRS KRMAVLKTIE KHLDFSSDAM DICDTSGVLK SACRNSESIN SSTDISSVED  600
EKMGAGHMIG LETLINDFAH TRKLDAS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C4e-70652321159MYB PROTO-ONCOGENE PROTEIN
1h89_C4e-70652321159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1477484RRRKREKP
2478483RRKREK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568309.10.0PREDICTED: cyclin-D-binding Myb-like transcription factor 1 isoform X1
RefseqXP_010231305.10.0PREDICTED: cyclin-D-binding Myb-like transcription factor 1 isoform X1
TrEMBLA0A0Q3K5700.0A0A0Q3K570_BRADI; Uncharacterized protein
STRINGBRADI2G23320.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30993880
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.21e-99myb domain protein 3r-5